PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0042s0046.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 419aa    MW: 48192.1 Da    PI: 8.9568
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0042s0046.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B351.51.8e-161191187
                         EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                   B3  1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87
                         ffkv    +++k+  + +p+ f e+++ + ++  t  l  +sg++W v++  +  ++  ++t+GW+ Fv++n +++gDf+ Fkl g+
  Kaladp0042s0046.1.p 11 FFKVYFADHSFKQ--MKIPRAF-EDYMDE-RKFGTAELAGRSGQTWLVEV--DYDGKDLYFTDGWQAFVEDNMVQDGDFLFFKLLGN 91
                         7888877777766..8*****9.588544.45559***************..888888*************************9886 PP

2B356.84.2e-18167258196
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                          f+k  t s+    + l++p  fa+eh+++ +++ +++l+++++ sW+v++   +++g++ l +GW  F+++n+L+ gD++ F+l+gr   
  Kaladp0042s0046.1.p 167 FEKHITISNIEHGHYLRIPSYFAQEHSLNYKSNEKMVLRTSRNSSWKVNI--INRGGEISLCRGWAAFARENNLRLGDVCNFELVGR--L 252
                          677777777777899***********88888999****************..999999*************************9985..5 PP

                          ..EEEE CS
                   B3  91 elvvkv 96 
                          e++v+v
  Kaladp0042s0046.1.p 253 EMLVHV 258
                          556665 PP

3B353.25.5e-17318413296
                          EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE..EEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                   B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr..yvltkGWkeFvkangLkegDfvvFkldgrse 89 
                          +  +++++v ks+ l +p  f++e+++  e++ +++l++e+   W + +i++k+ ++  + l++GW +Fv++n++kegD++ F+l++r e
  Kaladp0042s0046.1.p 318 VALMKKHHVEKSA-LNIPAWFFRENSLHYERNEKMVLRSEKDSLWLLSIIHSKYNNKtlCRLSGGWIDFVRDNNIKEGDTCKFELVNRLE 406
                          4455556666665.***********99999999****************99777777679999*********************997644 PP

                          E..EEEE CS
                   B3  90 felvvkv 96 
                           +++++ 
  Kaladp0042s0046.1.p 407 MKFHIMP 413
                          4344444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.94E-187104IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.0E-198104IPR015300DNA-binding pseudobarrel domain
CDDcd100171.17E-169100No hitNo description
PROSITE profilePS5086313.079102IPR003340B3 DNA binding domain
PfamPF023621.7E-141191IPR003340B3 DNA binding domain
SMARTSM010195.6E-1111102IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.1E-22160261IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.67E-20164260IPR015300DNA-binding pseudobarrel domain
CDDcd100171.09E-16165258No hitNo description
PROSITE profilePS5086314.015167262IPR003340B3 DNA binding domain
PfamPF023621.6E-15167258IPR003340B3 DNA binding domain
SMARTSM010198.9E-13167264IPR003340B3 DNA binding domain
SuperFamilySSF1019362.94E-18314413IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.6E-19314413IPR015300DNA-binding pseudobarrel domain
CDDcd100171.15E-16315411No hitNo description
PROSITE profilePS5086312.323316415IPR003340B3 DNA binding domain
PfamPF023621.9E-14317413IPR003340B3 DNA binding domain
SMARTSM010191.6E-16317415IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MDAEVDNLPE FFKVYFADHS FKQMKIPRAF EDYMDERKFG TAELAGRSGQ TWLVEVDYDG  60
KDLYFTDGWQ AFVEDNMVQD GDFLFFKLLG NLMFSFIIYD ETMCEKEAAF NGKCSRGRDG  120
VVEAVEEPMG LKPVKRRNMG CSQPEGSLFT SMDKTAVKTS TSVKPSFEKH ITISNIEHGH  180
YLRIPSYFAQ EHSLNYKSNE KMVLRTSRNS SWKVNIINRG GEISLCRGWA AFARENNLRL  240
GDVCNFELVG RLEMLVHVTH QDKVIEQKQL NVAAPKIRPS ERAVGVSQPK LRQGSPITTE  300
RQKAAGRSRP SLVKPSFVAL MKKHHVEKSA LNIPAWFFRE NSLHYERNEK MVLRSEKDSL  360
WLLSIIHSKY NNKTLCRLSG GWIDFVRDNN IKEGDTCKFE LVNRLEMKFH IMPRSKQD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130136LKPVKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.14e-18B3 family protein